SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000647 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000647
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 326-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 214-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-21
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 5 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 161-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-16
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000647   Gene: ENSGGOG00000000658   Transcript: ENSGGOT00000000663
Sequence length 477
Comment pep:known_by_projection chromosome:gorGor3.1:19:49263296:49272405:-1 gene:ENSGGOG00000000658 transcript:ENSGGOT00000000663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKAQESLTLKDVAVDFTWEEWQLLGPAQKHLYRDVMLENYSNLVSVGYQAGKPDALTKL
EQGEPLWTLEDEIHSPAHPEIEKADDHLQQPLQNQKILKRTGQRYEHGRTLKSYLGLTNQ
SRRYNRKEPAEFNGDGAFLHDNYEQMPMEIEFPESRKPISTKSQFLKHQQTHNIQKAHEC
TDCGKAFLKKSQLTEHKRIHTGKKPHVCSLCGKAFYKRYRLTEHERAHKGEKPYGCSECG
KAFPRKSELTEHQRIHTGIKPHQCSECGRAFSRKSLLVVHQRTHTGEKPHTCSECGKGFI
QKGNLNIHQRTHTGEKPYGCIDCGKAFSQKSCLVAHQRYHTGKTPFVCPECGQPCSQKSG
LIRHQKIHSGEKPYKCSDCGKAFLTKTMLIVHHRTHTGERPYGCDECEKAYFYMSCLVKH
KRIHSREKRGDSVKVDNPSTASHSLSPSEHVQGKSPVNMVTVAMVAGQCEFADILHS
Download sequence
Identical sequences G3QEF4
ENSGGOP00000000647 XP_004061370.1.27298 ENSGGOP00000000647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]