SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000680 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000680
Domain Number 1 Region: 11-95
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.87e-20
Family FHA domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000680
Domain Number - Region: 361-400
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0017
Family N-terminal coiled coil domain from apc 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000680   Gene: ENSGGOG00000000691   Transcript: ENSGGOT00000000696
Sequence length 1452
Comment pep:known_by_projection chromosome:gorGor3.1:1:15729313:15869748:1 gene:ENSGGOG00000000691 transcript:ENSGGOT00000000696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAYLKSAEGFFVLNKSTTIGRHEHSDLVLQSPDIDNHHALIEYNEAECSFVLQDFNSRN
GTFVNECHIQNVAVKLIPGDILRFGSAGLTYELVIENPPPVSFPWMRGPAPWPGPQPPRA
TQQPNQAPPLSHIPFHQGVQPAPMQRSWSQAFPRPTVVLPASHRRPVSANKEMFSFVVDD
ARKPPVIKQVWTNAMKLSEKSVAEGIPGAAPPAEIYVEEDLAQQDKDEIILLLGKEVSRL
SDYEIESKYKDVIIANLQNEVAELSQKVSETTTSRQNEKEISQKCQVLDEVIDAKQKEIQ
SLKSQISALQKGYSQVLCQTLSERNSEITSLKNEGENLKRDNAITSGMVSSLQKDMLAKD
EQVQQLKEEVSHLKSQNKDKDHQLEALGSRCSVLKEELKQEDAHRELREAQEKELKLCKT
QIQDMEKEMKKLRAELRKSCTEQSVISRTLREKSKVEEKLQEDSRRKLLQLQEMGNRESL
IKINLERAVGQLEHFRSQVIKATYGRAKPFPDKPITDQQLIEKITQVTEDNINFQQKKWT
LQKETQLSNSKQEETTENIEKLRTSLDSCQACMKISCCSHDLKKEVDLLQHLQVSPPVSG
LQKVVLDVLRHALSWLEEVEQLLRDLGIPPSSPNKDQVQQLSGNSAVFTARKAAGASGRE
GEAERGEARARGEAQSQNQATDGREGGKALEEYITQERNRAKETLEEERKRMQELESLLA
QQKKALAESITQEKNRVKEALEEEQTRVQELEECLARQKEVLESSIAHEKRKAKEALEVE
KRKVQDLENHLTQQKEISESNIAYEKRKAKEAMEKEKKKVQDLENRLTKQKEELELKEQK
EDVLNNKLSDALAMVEETQKTKATESLKAESLALKLNETLAELETTKTKMIMVEERLILQ
QKIVKALQDEQESQRHGFEEEIMEYKEQIKQHAQTIVSLEEKLQKVTQHHKRIEGEIATL
KDNDPAQKEERPQDPVPPMTESSAKDMAYEHLIDDLLAAQKEILSQQEVIMKLRKDLTEA
HSRMSDLRGELNEKQKMELERNVVLVQQQSKELSVLKEKMAQMSSLVEKKDRELKALKEA
LRASQEKHRLQLNTEKEQEPQKKTQTCDTSVQIEPVHTEAFSSSQEQQSFSDLGVRCKGS
RHEEVIQRQKKALSELRARIKELEKARLPDHKDHQNESFLDLKNLRMENNVQKILLDAKP
DLPTLSRIEILAPQNGLCNASFGSAMEKSGKMDVAEALELSEKLYLDMSKTLGSLMNIKN
MSGHVSMKYLSRQEREKVNQLRQRDLDLVFDKITQLKNQLGRKEELLRGYEKDVEQLRRS
KVSVEMYQSQVAKLEDDIYKEAEEKALLKEALERMEHQLCQEKRINRAIRQQKMRKLRLR
ELRGAQVHTVAGKEGWDLTPDPSDPGSPAVCRVSRKCKGARTEKRKRIDTLQLCLQRERQ
AAPAPPACSLNG
Download sequence
Identical sequences ENSGGOP00000000680 ENSGGOP00000022657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]