SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000720 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000720
Domain Number 1 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-26
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 526-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.08e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 571-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 291-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 42-88
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000275
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 
Domain Number 8 Region: 488-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000682
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000720   Gene: ENSGGOG00000000731   Transcript: ENSGGOT00000000736
Sequence length 630
Comment pep:known_by_projection chromosome:gorGor3.1:9:95526913:95548591:-1 gene:ENSGGOG00000000731 transcript:ENSGGOT00000000736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSSGDQILTKPETVDRRRSAGTTKEAGRPLEMAVSEPEASAAEWKQLDPAQSNLDNDV
MLENYSNQASMGCQAPKPDMISKLEKGEAPWLGKGKRPSQGCPSKIARPKQKETDGKVQK
DDDQLENIQKSQNKLLREVAVKKKTQAKKNGSDCGSLGKKNNLHTKHVPSKKRLLKFESR
GKILKQNLDLPDHSRNCVKRKSDAAKEHKKSFNHSLSDTRKGKKQTGKKHEKLSNHSSSD
KCNKTGKKHDKLCCHSSSHIKPDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGK
VLSHKQGLIDHQRVHTGEKPYECNECGIAFSQKSHLVVHQRTHTGEKPYECIQCGKAHGH
KHALTDHLRIHTGEKPYECAECGKTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSL
TEHVRTHTGEIPYECSECGKAFKYSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQ
RTHTKEKPYKCNECGKAFGHSSSLTYHMRTHTGESPFECNQCGKGFKQIEGLTQHQRVHT
GEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGEKP
YECNECGKTFKQNASLTKHVKTHSEEKSHE
Download sequence
Identical sequences XP_004048507.1.27298 ENSGGOP00000000720 ENSGGOP00000000720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]