SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000721 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000721
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily t-snare proteins 1.52e-34
Family t-snare proteins 0.00000124
Further Details:      
 
Domain Number 2 Region: 159-225
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000113
Family SNARE fusion complex 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000721   Gene: ENSGGOG00000000732   Transcript: ENSGGOT00000000737
Sequence length 255
Comment pep:known_by_projection chromosome:gorGor3.1:1:160478915:160528163:-1 gene:ENSGGOG00000000732 transcript:ENSGGOT00000000737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWD
LEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNR
QALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSI
GVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAI
LFAVLLVVLILFLVL
Download sequence
Identical sequences A0A2J8V7Z3 A0A2K5QQY0 A0A2K6V8Q8 G3QEM4 H2R1H0 O43752 Q5R6Q2
ENSPTRP00000042368 ENSPTRP00000042368 ENSP00000258301 NP_001126499.1.23681 NP_005810.1.87134 NP_005810.1.92137 XP_003824773.1.60992 XP_003925366.1.74449 XP_004028050.1.27298 XP_017379941.1.71028 XP_514037.2.37143 ENSP00000258301 ENSP00000258301 9598.ENSPTRP00000042368 9606.ENSP00000258301 gi|5032131|ref|NP_005810.1| ENSGGOP00000000721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]