SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000722 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000722
Domain Number 1 Region: 88-215
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.43e-36
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000722   Gene: ENSGGOG00000000733   Transcript: ENSGGOT00000000738
Sequence length 347
Comment pep:known_by_projection chromosome:gorGor3.1:6:164679898:164841642:1 gene:ENSGGOG00000000733 transcript:ENSGGOT00000000738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCGAWNMVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRK
DMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLE
AETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEE
VKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAP
VLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTL
APATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
Download sequence
Identical sequences ENSGGOP00000000722 ENSGGOP00000000722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]