SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000736 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000736
Domain Number 1 Region: 53-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000736   Gene: ENSGGOG00000000747   Transcript: ENSGGOT00000000752
Sequence length 209
Comment pep:known_by_projection chromosome:gorGor3.1:4:2255359:2269929:-1 gene:ENSGGOG00000000747 transcript:ENSGGOT00000000752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELNSLLILLEAAEYLERRDREAEHGYASVLPFDGDFAREKTKAAGLVRKAPNNRSSHNE
LEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKKLEEQDRRALSIKEQLQ
QEHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSVGSSSDA
DDHYSLQSGTGSDSGFGPHCRRLGRPALS
Download sequence
Identical sequences G3QEN7
ENSGGOP00000000736 ENSGGOP00000000736 XP_004038385.2.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]