SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000836 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000836
Domain Number 1 Region: 20-489
Classification Level Classification E-value
Superfamily Sema domain 9.94e-132
Family Sema domain 0.000017
Further Details:      
 
Domain Number 2 Region: 1336-1462,1657-1846
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-53
Family p120GAP domain-like 0.032
Further Details:      
 
Domain Number 3 Region: 1025-1129
Classification Level Classification E-value
Superfamily E set domains 5.1e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.075
Further Details:      
 
Domain Number 4 Region: 938-1026
Classification Level Classification E-value
Superfamily E set domains 9.17e-16
Family Other IPT/TIG domains 0.029
Further Details:      
 
Domain Number 5 Region: 838-940
Classification Level Classification E-value
Superfamily E set domains 0.000000000000149
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 6 Region: 492-544
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000157
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1126-1216
Classification Level Classification E-value
Superfamily E set domains 0.000000392
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 791-824
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000275
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000836   Gene: ENSGGOG00000000847   Transcript: ENSGGOT00000000854
Sequence length 1876
Comment pep:known_by_projection chromosome:gorGor3.1:3:126779694:126828440:1 gene:ENSGGOG00000000847 transcript:ENSGGOT00000000854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAEAGLPRAGGGSQPPFRTFSASDWGLTHLVVHEQTGEVYVGAVNRIYKLSGNLTLLRA
HVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDYAANRLLACGSASQGICQFLRL
DDLFKLGEPHHRKEHYLSSVREAGSMAGVLIAGPPGQGQAKLFVGTPIDGKSEYFPTLSS
RRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFRSEQFVYYLTLQL
DTQLTSPDAAGEHFFTSKIVRLCVDDPKFYSYVEFPIGCEQAGVEYRLVQDAYLSRPGRA
LARQLGLAEDEDVLFTVFAQGQKNRVKPPKESALCLFTLRAIKEKIKERIQSCYRGEGKL
SLPWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVTIEGMPLFVDKDDGLTAVAAYDYR
GRTVVFAGTRSGRIRKILVDLSNPGGRPALAYESVVAQEGSPILRDLVLSPNHQYLYAMT
EKQVTRVPVESCVQYTSCELCLGSRDPHCGWCVLHSICSRRDACERADEPQRFAADLLQC
VQLTVQPRNVSVTMSQVPLVLQAWNVPDLSAGVNCSFEDFTESESILEDGRIHCRSPSAR
EVAPITRGQGDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYR
HVCTHNVADCAFLEGRVNVSEDCPQILPSTQIYVPVGVVKPITLAARNLPQPQSGQRGYE
CLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDVSDLPVNLSVVWNGNFVIDNPQNIQ
AHLYKCPALRESCGLCLKADPRFECGWCVAERRCSLRHHCAADTPASWMHARHGSSRCAD
PKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGVRVGKVLCSPVESEYIKYISAEQI
VCEIGDASSVRAHDALVEVCVRDCSPHYRALSPKRFTFVTPTFYRVSPSRGPLSGGTWIG
IEGSHLNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEV
KYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDT
TMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVLEPLSPTGL
LELKPSSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCTLTVSETQLLCEAPNLTGQHKVT
VRAGGFEFSPGTLQVYSDSLLTLPAIVGIGGGGGLLLLVIVAVLIAYKRKSRDADRTLKR
LQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIEDHP
VLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGE
MEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEP
LFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEVPV
KGLDCDTVTQAKEKLLDAAYKGVPYSQRPKAADMDLEWRQGRMARIILQDEDVTTKIDND
WKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRT
PMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFET
IFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDADVRHTWKSNCLPLRFWVNVIKNPQFV
FDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKSWVERYYADI
AKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYITKYKDEILAALEKDEQARRQR
LRSKLEQVVDTMALSS
Download sequence
Identical sequences ENSGGOP00000000836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]