SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000898 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000898
Domain Number 1 Region: 92-262,309-380
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.91e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1172-1425
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.69e-34
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 532-761
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.41e-30
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 851-1006,1046-1122
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.06e-28
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000898
Domain Number - Region: 1433-1512
Classification Level Classification E-value
Superfamily EF-hand 0.00162
Family Polcalcin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000898   Gene: ENSGGOG00000000907   Transcript: ENSGGOT00000000917
Sequence length 1958
Comment pep:known_by_projection chromosome:gorGor3.1:X:50028769:50058074:-1 gene:ENSGGOG00000000907 transcript:ENSGGOT00000000917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESEGGKDTTPEPSPANGAGPGPEWGLCPGPPAVEGESSGASGLGTPKRRNQHSKHKTV
AVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPSPCASSGSGRACTLNQTECR
GRWPGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKQREKQQMEEDLRGYLDWITQAEELDMEDPS
ADGNLGSMAEEGRAGHRPQLAELTNRRRGRLRWFSHSTRSTHSTSSHASLPASDTGSMTE
TQGDEDEEEGALASCTRCLNKIMKTRVCRRLRRANRVLRARCRRAVKSNACYWAVLLLVF
LNTLTIASEHHGQPVWLTQIQEYANKVLLCLFTVEMLLKLYGLGPSAYVSSFFNRFDCFV
VCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLL
LLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDG
IMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKDKGVPGVEKE
EEEGARREGADMEEEEEEEEEEEEEEGAGGVELLQEVVPKEKVVPIPEGSAFFCLSQTNP
LRKGCHTLIHHHVFTNLILVFIILSSVSLAAEDPIRAHSFRNHILGYFDYAFTSIFTVEI
LLKMTVFGAFLHRGSFCRSWFNMLDLLVVSVSLISFGIHSSAISVVKILRVLRVLRPLRA
INRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYTCTDEAKHTPQE
CKGSFLVYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDAY
AEDHGPIYNYRVEISVFFIVYIIIIAFFMMNIFVGFVIITFRAQGEQEYQNCELDKNQRQ
CVEYALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMFLLILLNTVALAMQHYEQTAPFN
YAMDILNMVFTGLFTIEMVLKIIAFKPKHYFTDAWNTFDALIVVGSIVDIAVTEVNNGGH
LGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIAMIFF
IYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLASLPGNRCD
PESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHL
DEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDG
TVTFNATLFALVRTSLKIKTEGNLEQANQELRIVIKKIWKRMKQKLLDEVIPPPDEEEVT
VGKFYATFLIQDYFRKFRRRKEKGLLGNEAAPSTSSALQAGLRSLQDLGPEMRQALTCDT
EEEEEEGQEGVEEEDEKDLETNKATVVSQPSTRQGSRISVSLPVGDRLPDSLSFGPSDDD
RGTPTSSQPSVPQAGSNTHRRGSGALIFTIPEEGNSQPKGTKGQNKQDEDKEVPDRLSYL
DEQAGTPPCSVLLPPHRAQRYMDGHLVPRRRLLPPTPAGRKPSFTIQCLQRQGSCEDLPI
PGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGRSSGPLRTFTCLH
LPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNA
ASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHNL
Download sequence
Identical sequences ENSGGOP00000000898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]