SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000925 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000925
Domain Number 1 Region: 57-178
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.87e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000925   Gene: ENSGGOG00000000940   Transcript: ENSGGOT00000000946
Sequence length 346
Comment pep:known_by_projection chromosome:gorGor3.1:8:135390257:135587066:1 gene:ENSGGOG00000000940 transcript:ENSGGOT00000000946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVINKNMKLGQKV
LIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKY
FHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSEN
ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRG
LLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDSYDNSYSTPAQSGAD
YYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY
Download sequence
Identical sequences A0A2K5RFB1 A0A2K6LQZ5 A0A2K6RR42 G3QF60 K7AJE1 O75525
ENSP00000348108 ENSGGOP00000000925 gi|5730073|ref|NP_006549.1| ENSP00000348108 9598.ENSPTRP00000039806 9606.ENSP00000348108 ENSGGOP00000000925 ENSPTRP00000039806 ENSPTRP00000039806 ENSP00000348108 NP_006549.1.87134 NP_006549.1.92137 XP_004047610.1.27298 XP_010362808.1.97406 XP_016815389.1.37143 XP_017355244.1.71028 XP_017355250.1.71028 XP_017719308.1.44346 XP_018888137.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]