SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001005 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001005
Domain Number 1 Region: 26-193
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.91e-37
Family MHC antigen-recognition domain 0.0000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001005   Gene: ENSGGOG00000001019   Transcript: ENSGGOT00000001027
Sequence length 238
Comment pep:known_by_projection chromosome:gorGor3.1:20:32565918:32571287:1 gene:ENSGGOG00000001019 transcript:ENSGGOT00000001027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEG
PDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCEL
PPESSRPHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELRE
FLEDTCVQYVQKHTSAENTKGSQTSRSYTSLVLGVLVGSFIIAGVAVGIFLCTGGRRC
Download sequence
Identical sequences G3QFD6
XP_004062098.1.27298 ENSGGOP00000001005 ENSGGOP00000001005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]