SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001036 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001036
Domain Number 1 Region: 46-153
Classification Level Classification E-value
Superfamily SH2 domain 1.13e-19
Family SH2 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001036   Gene: ENSGGOG00000001052   Transcript: ENSGGOT00000001060
Sequence length 171
Comment pep:known_by_projection chromosome:gorGor3.1:2a:86952665:86954285:1 gene:ENSGGOG00000001052 transcript:ENSGGOT00000001060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYASSYPPPQQLSPRSRLCPPTPPQLNNLLLLEGRKSSVPSVAPTGSASAAEDGDLLAQP
WYSGNCDRYAVESALLHLQKDGAYTVRPSSGPHGSQPFTLAVLLRGRVFNIPIWRLDGGR
HYALGREGRNHEELFSSVAAMVQHFMWHPLPLVDRHSGSRELTCLLFPTKP
Download sequence
Identical sequences ENSGGOP00000001036 ENSGGOP00000001036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]