SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001119 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001119
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-23
Family KRAB domain (Kruppel-associated box) 0.00033
Further Details:      
 
Domain Number 2 Region: 211-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 3 Region: 327-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 253-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000011
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 155-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000142
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 304-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000105
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001119   Gene: ENSGGOG00000001135   Transcript: ENSGGOT00000001143
Sequence length 398
Comment pep:novel chromosome:gorGor3.1:19:12183686:12198967:1 gene:ENSGGOG00000001135 transcript:ENSGGOT00000001143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFQDPVAFEDVAVNFTQEEWALLDISQRKLYREVMLETFRNLTSIGKKWKDQNIEYEYQ
NPRRNFRSLIEEKVNEIKEDSHCGETFTPVPDDRLNFQEKKASPEVKSCESFVWGEVGIG
NSSFNMNIRGDIGHKAYEYQDYAPKPYKCQQPKKAFRYRPSFRTQERNPTREKPYACKEC
GKTFISHSGIRRRMVMHSGDGPYKCKFCGKAFHCLRLYLIHERIHTGEKPYECKQCVKSF
SYSATLRIHERTHTGEKPYECQQCGKAFHSSSSFQAHKRTHTGGKPYERKQSGKSFSWCH
SFQIHEITHTREKPYERSKCNKAFSHRSYLRHKRSHTGEKPYQCKECRKAFTYPSSLRRH
ERTHSEKKPDECKQYGKALSYLIKFSNTPKNALWRKTL
Download sequence
Identical sequences ENSGGOP00000001119 ENSGGOP00000001119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]