SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001180 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001180
Domain Number 1 Region: 192-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.31e-118
Family Transglutaminase core 0.0000000000103
Further Details:      
 
Domain Number 2 Region: 8-191
Classification Level Classification E-value
Superfamily E set domains 2.13e-57
Family Transglutaminase N-terminal domain 0.00000000772
Further Details:      
 
Domain Number 3 Region: 517-628
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.44e-32
Family Transglutaminase, two C-terminal domains 0.000000819
Further Details:      
 
Domain Number 4 Region: 634-729
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.49e-27
Family Transglutaminase, two C-terminal domains 0.00000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001180   Gene: ENSGGOG00000001196   Transcript: ENSGGOT00000001204
Sequence length 733
Comment pep:known_by_projection chromosome:gorGor3.1:6:6270907:6460024:-1 gene:ENSGGOG00000001196 transcript:ENSGGOT00000001204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETSRTTFGGRRAVPPNNSNAAEDDLPTVELQGMVPRGVNLQEFLNVTSVHLFKERWDT
NKVDHHTDKYENNKLIVRRGQSFYVQIDFNRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETD
TYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTCL
YVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITD
TYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSNVDMDFEVENAVLGKDFKLSITF
RNNSHNRYTITAYLSANITFYTGVPKAEFKKETFDVMLEPLSFKKEAVLIQASEYMGQLL
EQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIIKVRGTQVVGSDMTVTVEFTNPLKE
TLRNVWIHLDGPGITRPMKKMFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDSLRHVY
GELDVQIQRRPSM
Download sequence
Identical sequences ENSGGOP00000001180 ENSGGOP00000001180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]