SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001223 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001223
Domain Number 1 Region: 1-285
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.05e-76
Family Pancreatic carboxypeptidases 0.00000000031
Further Details:      
 
Domain Number 2 Region: 288-385
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 8.83e-24
Family Carboxypeptidase regulatory domain 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001223   Gene: ENSGGOG00000001238   Transcript: ENSGGOT00000001247
Sequence length 417
Comment pep:known_by_projection chromosome:gorGor3.1:12:67260126:67342331:-1 gene:ENSGGOG00000001238 transcript:ENSGGOT00000001247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAFLKTVAQNYSSITHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGDET
VGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENY
NQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKTETFVLSANLHGGALVASYPFDNGVQAT
GALYSRSLTPDDDVFQYLAHTYASRNPNMKKGDECKNKMNFPNGVTNGYSWYPLQGGMQD
YNYIWAQCFEITLELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLAGVKGQVFDQNGNP
LPNVIVEVQDRKHICPYRTNKYGEYYLLLLPGSYIINVTVPGHDPHITKVIIPEKSQNFS
ALKKDILLPFQGQLDSIPVSNPSCPMIPLYRNLPDHSAATKPSLFLFLVSLLHIFFK
Download sequence
Identical sequences ENSGGOP00000001223 ENSGGOP00000001223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]