SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001224 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001224
Domain Number 1 Region: 144-258
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-17
Family Ras-binding domain, RBD 0.005
Further Details:      
 
Domain Number 2 Region: 381-488
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000000227
Family FHA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001224   Gene: ENSGGOG00000001240   Transcript: ENSGGOT00000001248
Sequence length 824
Comment pep:known_by_projection chromosome:gorGor3.1:19:46007228:46027765:-1 gene:ENSGGOG00000001240 transcript:ENSGGOT00000001248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGERKEGGSPRFGKLHLPVGLWINSPRKQLAKLGRRWPSAASVKSSSSDTGSRSSEPL
PPPPPHVELRRVGAVKAAGGASGSRAKRISQLFRGSGTGTTGSGGAGGPGTPGGAQRWAS
EKKLPELAAGVAPEPPLATRATAPPGVLKIFGAGLASGANYKSVLATARSTARELVAEAL
ERYGLAGSPGGGPGESSCVDAFALCDALGRPAAAGVGSGEWRAEHLRVLGDSERPLLVQE
LWRARPGWARRFELRGREEARRLEQEAFGAADSEGTGAPSWRPQKNRSRAASGGAALASP
GPGTGSGAPAGSGGKERSENLSLRRSVSELSLQGRRRRQQERRQQALSMAPGAADAQIGP
ADPGDFDQLTQCLIQAPSNRPYFLLLQGYQDAQDFVVYVMTREQHVFGRGGNSSGRGGSP
APYVDTFLNAPDILPRHCTVRAGPEHPAMVRPSRGAPVTHNGCLLLREAELHPGDLLGLG
EHFLFMYKDPRTGGSGPARPPWLPARPGATPPGPGWAFSCRLCGRGLQERGEALAAYLDG
REPVLRFRPREEEALLGEIVRAAAAGAGDLPPLGPATLLALCVQHSARELELGHLPRLLG
RLARLIKEAVWEKIKEIGDRQPENHPEGVPEVPLTPEAVSVELRPLMLWMANTTELLSFV
QEKVLEMEKEADQEDPQLCNDLELCDEAMALLDEVIMCTFQQSVYYLTKASWSSLRTDHP
TLTPAQLHHLLSHYQLGPGRGPPAAWDPPPAEREAVDTGDIFESFSSHPPLILPLGSSRL
RLTGPVTDDALHRELRRLRRLLWDLEQQELPANYRHGPPVATSP
Download sequence
Identical sequences ENSGGOP00000001224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]