SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001430 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001430
Domain Number 1 Region: 823-880
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000876
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 2 Region: 647-704
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 3 Region: 705-761
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 884-935
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000124
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 52-81
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000432
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 765-818
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 7 Region: 594-644
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000562
Family TSP-1 type 1 repeat 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001430   Gene: ENSGGOG00000001447   Transcript: ENSGGOT00000001457
Sequence length 986
Comment pep:known_by_projection chromosome:gorGor3.1:15:50589659:51262736:1 gene:ENSGGOG00000001447 transcript:ENSGGOT00000001457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSHFMGSLSVLCFLLLLGFQFVCPQPSTQHRKVPQRMAAEGAPEDGGGGAPGVWGAWGP
WSACSRSCSGGVMSAVRTSVPLHRSRDETPALAGTDASRQGPTVLRGSRHPQPQGLEVTG
DRRSRTRGTIGPGKYGYGKAPYILPLQTDTAHTPQRLRRQKLSSRHSRSQGTSSARHGYS
SPAHQVPQHGPLYQSDSVPRSGLQAAEAPIYQLPLTHDQGYPAASSLFHSPETSNNHGVG
THGATQSFSQPARSTAISCIGAYRQYKLCNTNVCPESSRSIREVQCASYNNKPFMGRFYE
WEPFAEVKGNRKCELNCQAMGYRFYVRQAEKVIDGTPCDQNGTAICVSGQCKSIGCDDYL
GSDKVVDKCGVCGGDNTGCQVVSGVFKHALTSLGYHRVVEIPEGATKINITEMYKSNNYL
ALRSRSGRSIINGNWAIDRPGKYEGGGTMFTYKRPNEISSTAGESFLAEGPTNEILDVYM
IHQQPNPGVHYEYVIMGTNAISPQVPPHRRPGEPFNGQMVTEGRSQEEGEEKGRNEEKED
LRGEAPEMLTSESAQTFPVRHPDRFSPRRPDNLVPPAPQPPRRSRDHNWKQLGTTECSTT
CGKGSQYPIFRCVHRSTHEEAPESYCDSSMKPTPEEEPCNIFPCPAFWDIGEWSECSKTC
GLGMQHRQVLCRQVYANRSLTVQPYRCQHLEKPETTSTCQLKICSEWQIRTDWTSCSVPC
GVGQRTRDVKCVSNIGDVVDDEECNMKLRPNDIENCDMGPCAKSWFLTEWSERCSAECGA
GVRTRSVVCMTNHVSSLPLEGCGNNRPAEATPCDNGPCTGKVEWFAGSWSQCSIECGSGT
QQREVICVRKNADTFEVLDPSECSFLEKPPSQQSCHLKPCGAKWFSTEWSMCSKSCQGGF
RVREVRCLSDDMTLSNLCDPQLKPEERESCNPQDCVPEVDENCKDKYYNCNVVVQARLCV
YNYYKTACCASCTRVANRQTGFLGSR
Download sequence
Identical sequences ENSGGOP00000001430 ENSGGOP00000001430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]