SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001459 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001459
Domain Number 1 Region: 41-138
Classification Level Classification E-value
Superfamily SH2 domain 4.43e-29
Family SH2 domain 0.00000463
Further Details:      
 
Domain Number 2 Region: 268-329
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-22
Family SH3-domain 0.0000371
Further Details:      
 
Domain Number 3 Region: 3-54
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000103
Family SH3-domain 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001459
Domain Number - Region: 190-227
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000523
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001459   Gene: ENSGGOG00000001476   Transcript: ENSGGOT00000001486
Sequence length 330
Comment pep:known_by_projection chromosome:gorGor3.1:22:24230074:24298734:1 gene:ENSGGOG00000001476 transcript:ENSGGOT00000001486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIRFPEWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP
SMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDIN
DGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWVRALYDFEALEDDELGFHSGEVVEV
LDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Download sequence
Identical sequences G3QGK0
ENSGGOP00000001459 ENSGGOP00000001459 XP_004063555.1.27298 XP_004063556.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]