SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001542 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001542
Domain Number 1 Region: 141-286
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.27e-24
Family Cell cycle control phosphatase, catalytic domain 0.0019
Further Details:      
 
Domain Number 2 Region: 310-394
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000068
Family Dual specificity phosphatase-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001542   Gene: ENSGGOG00000001563   Transcript: ENSGGOT00000001573
Sequence length 394
Comment pep:known_by_projection chromosome:gorGor3.1:1:202027355:202089047:-1 gene:ENSGGOG00000001563 transcript:ENSGGOT00000001573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSATPGSNSHPPVIATTVVSLKAANLTY
MPSSSGSARSLNCGCSSASCCTVATYDKDNQAQTQAIAAGTTTTAIGTSTTCPANQMVNN
NENTGSLSPSSGVGSPVSGTPKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPF
MEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENT
NEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQECREVGGGA
SAASSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQQLNIGYVINVTTHLPL
YHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFI
Download sequence
Identical sequences ENSGGOP00000001542 ENSGGOP00000001542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]