SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001566 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001566
Domain Number 1 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 422-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-19
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000137
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001566   Gene: ENSGGOG00000004150   Transcript: ENSGGOT00000001599
Sequence length 484
Comment pep:known_by_projection chromosome:gorGor3.1:19:55143101:55146706:-1 gene:ENSGGOG00000004150 transcript:ENSGGOT00000001599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGCVTFEDVAIYFSQEEWGLLDEAQRLLYRDVMLENFALITALGLASFRSQVVAHLEVVG
KPWLLEREDGNMASEEVCWHGMEDEETPEQSVSVEPPSSNILHHQKHHSAEKPLESDMDK
ASFVQCCLFHESGMPFTSSEVGKDFLAPLRILQPQAIANYEKPNKISKCEEAFHVGISHY
KWSQCRRESSHKHTFFPSLGKRLYESSKCGKACCCECSLVQLQRVHPGERPYECSECGKS
FSQTSHLNDHRRIHTGERPYVCGQCGKSFSQRATLIKHHRVHTGERPYECGECGKSFSQS
SNLIEHCRIHTGERPYECDECGKAFGSKSTLVRHQRTHTGEKPYECGECGKLFRQSFSLV
VHQRIHTTARPYECGQCGKSFSLKCGLIQHQLIHSGARPFECDECGKSFSQRTTLNKHHK
VHTAERSYVCGECGKAFMFKSKLVRHQRTHTGERPFECSECGKFFRQSYTLVEHQKIHTG
LMWT
Download sequence
Identical sequences ENSGGOP00000001566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]