SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001652 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001652
Domain Number 1 Region: 102-166
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.66e-25
Family SCAN domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001652   Gene: ENSGGOG00000001678   Transcript: ENSGGOT00000001688
Sequence length 179
Comment pep:known chromosome:gorGor3.1:20:33352893:33353775:-1 gene:ENSGGOG00000001678 transcript:ENSGGOT00000001688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEA
IPTPRAAASAALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAA
GPREAFRQLRELSRQWLRPDIRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG
Download sequence
Identical sequences A1YEW3 P57086
ENSGGOP00000001652 NP_057642.1.87134 NP_057642.1.92137 ENSGGOP00000001652 9606.ENSP00000301995 ENSP00000301995 ENSP00000363103 ENSP00000481289 gi|7706089|ref|NP_057642.1| ENSP00000301995 ENSP00000301995 ENSP00000363103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]