SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001796 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001796
Domain Number 1 Region: 16-175
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.08e-38
Family Dual specificity phosphatase-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001796   Gene: ENSGGOG00000001822   Transcript: ENSGGOT00000001834
Sequence length 223
Comment pep:known_by_projection chromosome:gorGor3.1:14:33480465:33525138:1 gene:ENSGGOG00000001822 transcript:ENSGGOT00000001834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPILQKHGITHI
ICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHG
NAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTI
QMMSPLQIERSLSVHSGTTGSLKRTHEEEDDFGTMQVATAQNG
Download sequence
Identical sequences A0A2I3H8M7 G3QHG7 Q5RDP3
ENSNLEP00000015284 ENSNLEP00000015284 NP_001153320.1.23681 XP_012359902.1.23891 XP_018865659.1.27298 ENSGGOP00000001796 ENSGGOP00000001796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]