SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001889 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001889
Domain Number 1 Region: 92-319
Classification Level Classification E-value
Superfamily t-snare proteins 2.55e-43
Family t-snare proteins 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001889   Gene: ENSGGOG00000001919   Transcript: ENSGGOT00000001930
Sequence length 356
Comment pep:known_by_projection chromosome:gorGor3.1:11:59595949:59621297:-1 gene:ENSGGOG00000001919 transcript:ENSGGOT00000001930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSCRDR
TQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAK
RKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQ
SKLASMSNDFKSVLEVRTENLKQQRSRREQFSRAPVSALPLAPNHLGGGGAVVLGAESHA
SKDVAIDMMDSRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEE
TIQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA
Download sequence
Identical sequences G3QHQ6
ENSGGOP00000001889 ENSGGOP00000001889 XP_004051431.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]