SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002051 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002051
Domain Number 1 Region: 30-273
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.96e-86
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00000000963
Further Details:      
 
Domain Number 2 Region: 260-414
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.43e-58
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002051   Gene: ENSGGOG00000002081   Transcript: ENSGGOT00000002095
Sequence length 416
Comment pep:known_by_projection chromosome:gorGor3.1:12:120576273:120598381:1 gene:ENSGGOG00000002081 transcript:ENSGGOT00000002095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLSPMAAALLARASGPVRRALCPRAWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPI
AAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIM
SVNNSLYLGPILKFGSKEQKQKWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDS
WVLNGTKAWITNAWEASAAVVFASTDRALQNKGISAFLVPMPTPGLTLGKKEDKLGIRGS
STANLIFEDCRIPKDSILGEPGMGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAEN
RMAFGAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAA
TAISHQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS
Download sequence
Identical sequences ENSGGOP00000002051 ENSGGOP00000002051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]