SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002056 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002056
Domain Number 1 Region: 80-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000146
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 479-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000107
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 709-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000139
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 527-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000316
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 617-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000101
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 772-796
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000279
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 7 Region: 571-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000406
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002056
Domain Number - Region: 138-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00428
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002056   Gene: ENSGGOG00000002088   Transcript: ENSGGOT00000002101
Sequence length 880
Comment pep:known_by_projection chromosome:gorGor3.1:20:62231843:62241570:-1 gene:ENSGGOG00000002088 transcript:ENSGGOT00000002101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGRRLPGSSKSGPGKDGSRKEVRLPMLHDPPKMGMPVVRGGQTVPSQAPLCFD
PGSPASDKTEGKKKGRPKAENQALRDIPLSLMNDWKDEFKAHSRVKCPNSGCWLEFPSIY
GLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDRPLPASKPGPISRPV
TISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVSVGRPMPVTKAIPVTRPVPVTKPV
TVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVTKPITVTKLVTVTKPVPVTKSVTVSRPI
AISRHTPPCKMVLLTRSENKAPRATGRNSGKKRAADSLDTCPIPPKQARPENGEYGPSSM
GQSSAFQLSADTSSGSLSPGSRPSGGMEALKAAGPASPPEEDPERTKHRRKQKTPKKFTG
EQPSISGTFGLKGLVKAEDKARVHRSKKQEGPGSEDARKKVPAAPITVSKEAPAPVAHPA
PGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDALKCQHCRKQFKSK
AGLNYHTMAEHSAKPSDSEASAGGEQEERERLRKVLKQMGRLRCPQEGCGAAFSSLMGYQ
YHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHVRSEHTAPPPEEPTDKSPEAEDPL
GVERTPSGRVRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETARLNYTRPGLPTL
NPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGAHLAGKYRCLLCPKE
FSSESGVKYHILKTHAENWFRTSAGPPPKHRSQDSLVPKKEKKKNLAGGKKRGRKPKERT
PEEPVAKLPPRRDDWPPGCRDKGARGSTGRKVGAGKAPEK
Download sequence
Identical sequences ENSGGOP00000002056 ENSGGOP00000002056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]