SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002070 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002070
Domain Number 1 Region: 61-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-24
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 2 Region: 256-362
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 9.3e-20
Family Platelet-derived growth factor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002070   Gene: ENSGGOG00000002102   Transcript: ENSGGOT00000002115
Sequence length 370
Comment pep:known_by_projection chromosome:gorGor3.1:11:101479446:101737848:-1 gene:ENSGGOG00000002102 transcript:ENSGGOT00000002115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRLIFVYTLICANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKG
NGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASE
TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMY
LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERC
DCICSSRPPR
Download sequence
Identical sequences A0A2I3SLM0 G3QI67 Q9GZP0
9598.ENSPTRP00000007275 9606.ENSP00000376865 ENSGGOP00000002070 gi|13376808|ref|NP_079484.1| NP_079484.1.87134 NP_079484.1.92137 XP_003828415.1.60992 XP_004052090.1.27298 XP_522165.2.37143 ENSGGOP00000002070 ENSP00000376865 ENSPTRP00000007275 ENSPTRP00000007275 ENSP00000376865 ENSP00000302193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]