SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002098 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002098
Domain Number 1 Region: 197-257
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002098   Gene: ENSGGOG00000002130   Transcript: ENSGGOT00000002143
Sequence length 425
Comment pep:novel chromosome:gorGor3.1:13:18077727:18123849:-1 gene:ENSGGOG00000002130 transcript:ENSGGOT00000002143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALL
DDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGTDIAL
TEPLTMEKMSNVVKYWTTCPSNTVKIENATGPEELGLPLQRSYSEHLGYFPADLFACPES
LRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRERIKYCCEQLRTLLPYVKGRKNDAAS
VLEATVDYVKYIREKISPAIMAQITEALQSNMRFCKKQQTPIELSLPGTVMAQRENSVMS
TYSPERGLQFLTNTCWNGCSTPDAESSLDEAVRVPSSSTSENAIGDPYKTHIPSAALSLN
SLHTVRYYSKVTPSYDATAVTNQNISIHLPSAVPPVSKLLPRHCTSGLGQTCTTHPNCLQ
QFWAY
Download sequence
Identical sequences ENSGGOP00000002098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]