SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002106 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002106
Domain Number 1 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 550-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 40-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 494-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 607-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 236-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000295
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002106   Gene: ENSGGOG00000002140   Transcript: ENSGGOT00000002151
Sequence length 682
Comment pep:known_by_projection chromosome:gorGor3.1:9:78810003:78830848:-1 gene:ENSGGOG00000002140 transcript:ENSGGOT00000002151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPHPEAITDCVTPNTVGQLAEGGYPLRFSTLFQEQQKMNISQASVSFKDVTIEFTQEEW
QQMAPVQKNLYRDVMLENYSNLVSVGYCRFKPEVIFKLEQGEEPWFSEEEFSNQSHPKDY
RGDDLIKQNKKIKHLEQAICINNKTLTTEEEKVLGKPFTLHVAAVASTKMSCKCDSWEVN
LQSISEFIINNRNYSTKKIGCGNVCENSLFKINFEKTQTGEKFYEHNKNMKALNYNENLP
KHPKFQTLEQAFECNKIGKAFNDKANCVKHKSPHTGETASKDDEFRKNCDKKTLFDHKRT
GTGKKHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNSSRNNFNRKAHLTDPQTAVTEEN
PLVSNDRTQTWVKSSEYHENKKSYQTSVHRVRRRSHSMIKPYKCNECGRSFCQKGHLIQH
QRTHTGEKPFECSECGKTFSQKSHLSTHQRIHTAEKPYKCNECGKTFVQKSTLRGHQRIH
TGEKPYKCSECGKTFVQKSTLRDHHRIHTGEKSFQCNQCGKTFGQKSNLRIHQRTHTGEK
TYQCNECEKSFWRKDHLIQHQKTHTGEKPFKCNECGKTFARTSTLRVHQRIHTGEKPFKC
NECGKKFVRKAILSDHQRIHTGEKPFQCNKCGKTFGQKSNLRIHQRTHSGEKSYECNEYG
KLCKKSTLSLYQKIQGEGNHPY
Download sequence
Identical sequences ENSGGOP00000002106 ENSGGOP00000002106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]