SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002381 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002381
Domain Number 1 Region: 70-164
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000176
Family Canonical RBD 0.0019
Further Details:      
 
Domain Number 2 Region: 751-835
Classification Level Classification E-value
Superfamily PWI domain 0.00000196
Family PWI domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002381   Gene: ENSGGOG00000002415   Transcript: ENSGGOT00000002432
Sequence length 843
Comment pep:known_by_projection chromosome:gorGor3.1:14:54297050:54365065:1 gene:ENSGGOG00000002415 transcript:ENSGGOT00000002432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFPPHLNRPPMGIPALPPGIPPPQFPGFPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSM
VGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQ
GASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKASN
GNARPETVTNDDEEALDEETKRRDQMIKGAIEVLIREYSSELNAPSQESDSHPRKKKKEK
KEDIFRRFPVAPLIPYPLITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEK
ERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRD
RDRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERE
REREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAE
REEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREK
EELEEIRQRLLAEGHPDPDAELQRMEQEAERRRQPQIKQEPESEEEEEEKQEKEEKREEP
MEEEEEPEQKPCLKPTLRPISSAPSVSSASGNATPNTPGDESPCGIIIPHENSPDQQQPE
EHRPKIGLSLKLGASNSPGQPNSVKRKKLPVDSVFNKFEDEDSDDVPRKRKLVPLDYGED
DKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKII
EYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIG
LVK
Download sequence
Identical sequences G3QJ05 H2Q8K0 P49756
ENSGGOP00000002381 ENSP00000261973 ENSP00000431150 ENSP00000261973 ENSP00000431150 ENSPTRP00000011043 ENSPTRP00000011043 9598.ENSPTRP00000011043 9606.ENSP00000261973 NP_067062.1.87134 NP_067062.1.92137 XP_001149216.1.37143 XP_003824181.1.60992 XP_004055454.1.27298 XP_008976104.1.60992 XP_008976105.1.60992 XP_011535346.1.92137 XP_016781819.1.37143 ENSGGOP00000002381 gi|55741709|ref|NP_067062.1| ENSP00000261973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]