SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002569 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002569
Domain Number 1 Region: 82-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000942
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002569   Gene: ENSGGOG00000002612   Transcript: ENSGGOT00000002623
Sequence length 214
Comment pep:known_by_projection chromosome:gorGor3.1:2a:27615720:27619597:1 gene:ENSGGOG00000002612 transcript:ENSGGOT00000002623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRKARGPPAMPGVGHSQTQAKARLLPGADRKRSRLSRTRQDPWEERSWSNQRWSRTTP
GPRGTRAGGLALGRSEASPENAARERSRVRTLRQAFLALQAALPAVPPDTKLSKLDVLVL
AASYIAHLTRTLGHELPGPAWPPFLRGLRYLHPLKKWPMRSRLYAGGLGYSDLDSTTAST
PSQRTRDAEVGSQVPGEADALLSTTPLSPALGDK
Download sequence
Identical sequences G3QJH4
XP_004029033.1.27298 ENSGGOP00000002569 ENSGGOP00000002569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]