SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002670 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002670
Domain Number 1 Region: 277-325
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002670   Gene: ENSGGOG00000002707   Transcript: ENSGGOT00000002724
Sequence length 331
Comment pep:known_by_projection chromosome:gorGor3.1:4:1179719:1185602:-1 gene:ENSGGOG00000002707 transcript:ENSGGOT00000002724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENPSPAAALGKALCALLLATLGAAGQPLGGESVCSARAPAKYSITFTGKWSQTAFPKQY
PLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSV
HAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQA
ALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVT
LVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGPCGRLGTKS
RTRYVRVQPANNGSPCPELEEEAECVPDNCV
Download sequence
Identical sequences G3QJR7 H2QP32
9598.ENSPTRP00000027253 XP_004038367.1.27298 XP_009445472.1.37143 XP_016808203.1.37143 ENSPTRP00000027253 ENSPTRP00000027253 ENSGGOP00000002670 ENSGGOP00000002670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]