SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002715 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002715
Domain Number 1 Region: 81-153
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.95e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002715   Gene: ENSGGOG00000002752   Transcript: ENSGGOT00000002769
Sequence length 214
Comment pep:known_by_projection chromosome:gorGor3.1:10:82056900:82058230:-1 gene:ENSGGOG00000002752 transcript:ENSGGOT00000002769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRK
LRARRGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLT
KIETLRFAHNYIWALTQTLRIADHSLYALESPAPHCGELGSPGGSPGDWGSLYSPVSQAG
SLSPAASLEERPGLLGASSSACLSPGTLAFSDFL
Download sequence
Identical sequences A0A2I2ZFA1
ENSGGOP00000002715 ENSGGOP00000002715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]