SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002971 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002971
Domain Number 1 Region: 46-138
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.24e-38
Family SCAN domain 0.0000629
Further Details:      
 
Domain Number 2 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.54e-27
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 531-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 685-737
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 381-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 224-285
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000119
Family KRAB domain (Kruppel-associated box) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002971   Gene: ENSGGOG00000003024   Transcript: ENSGGOT00000003037
Sequence length 754
Comment pep:known_by_projection chromosome:gorGor3.1:3:45692212:45708408:1 gene:ENSGGOG00000003024 transcript:ENSGGOT00000003037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTAGRGNLGLIPRSTAFQKQEGCLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHLSGPEEVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAH
LEPPYDPGTHHLPNGDFAQCASPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDY
TQKKWKGLTLSQRALQWNMMPENHYSMASLAGENVMKGSELTPKQEIFKGSESSNRTSGG
LFGVVPGAAETGDVCEDTFKELEGQTSDEEGSRLENDFLEITDEDKKKSTKDRYDKYKEV
GEHPHLSSSPVEHEGVLKGQKSYRCDECGKAFNRSSHLIGHQRIHTGEKPYECNECGKTF
RQTSQLIVHLRTHTGEKPYECIECGKAYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSS
RLIDHQRTHTGEKPYECNECGEAFIRSKSLARHQVLHTGKKPYKCNECGRAFCSNRNLID
HQRIHTGERPYECSECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLIEHERI
HTGEKPFECSECGKAFGLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGE
KPYECNECGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAFSDSSQLIVHQRVHTGEKPYE
CSECGKAFSQRSTFNHHQRTHTGEKSSGLAWSVS
Download sequence
Identical sequences G3QKJ6
ENSGGOP00000002971 ENSGGOP00000024971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]