SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003019 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003019
Domain Number 1 Region: 400-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 344-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.22e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 30-92
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 497-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.29e-19
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 232-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 191-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000398
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003019   Gene: ENSGGOG00000003075   Transcript: ENSGGOT00000003087
Sequence length 560
Comment pep:known_by_projection chromosome:gorGor3.1:8:145016842:145024858:-1 gene:ENSGGOG00000003075 transcript:ENSGGOT00000003087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLSDQLLLTALRKPNPQAMAALFLSAPHQAKVTFEDVAVYLSREEWGRLGPAQRGLY
RDVMLETYGNLVSLGVGPAGPKPGVISQLERGDEPWVLDVQGTSGKEHLRVNSPALGIRT
EYKELTSQETFGEEDPQGSEPVEACDHIRKSEGSLEKLVEQRGPRAVTLANGESSRESGG
NLRLLSRPVPDQRPHKCDICEQSFEQRSYLNNHKRVHRSKKTNTVRDSGEIFSANLVVKE
DQKIPTGKKLHYCSYCGKTFRYSANLVKHQRLHTEEKPYKCDECGKAFSQSCEFINHRRM
HSGEIPYRCDECGKTFTRRPNLMKHQRIHTGEKPYKCGECGKHFSAYSSLIYHQRIHTGE
KPYKCNDCGKAFSDGSILIRHRRTHTGEKPFECKECGKGFTQSSNLIQHQRIHTGEKPYK
CNECEKAFIQKTKLVEHQRSHTGEKPYECNDCGKVFSQSTHLIQHQRIHTGEKPYKCSEC
GKAFHNSSRLIHHQRLHHGEKPYRCSDCKKAFSQSTYLIQHRRIHTGEKPYKCSECGKAF
RHSSNMCQHQRIHLREDFSM
Download sequence
Identical sequences ENSGGOP00000003019 ENSGGOP00000003019 XP_004047753.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]