SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gorilla gorilla 76_3.1 > ENSGGOP00000003040

Domain assignment for ENSGGOP00000003040 from Gorilla gorilla 76_3.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGGOP00000003040
Domain Number 1	Region: 100-217
Classification Level	Classification	E-value
Superfamily	Cystatin/monellin	1.53e-50
Family	Latexin-like	0.000000365
Further Details:

Domain Number 2	Region: 1-98
Classification Level	Classification	E-value
Superfamily	Cystatin/monellin	3.06e-36
Family	Latexin-like	0.00000206
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGGOP00000003040 Gene: ENSGGOG00000003092 Transcript: ENSGGOT00000003108
Sequence length	222
Comment	pep:known_by_projection chromosome:gorGor3.1:3:159403914:159410179:-1 gene:ENSGGOG00000003092 transcript:ENSGGOT00000003108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEE IIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEDDNTFYQRLKSMKEPLEAQ NIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDY TILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Download sequence
Identical sequences	G3QKQ9 XP_004037964.1.27298 ENSGGOP00000003040 ENSGGOP00000003040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]