SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003108 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003108
Domain Number 1 Region: 68-173
Classification Level Classification E-value
Superfamily SRCR-like 5.23e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000562
Further Details:      
 
Domain Number 2 Region: 945-1050
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000505
Further Details:      
 
Domain Number 3 Region: 1298-1403
Classification Level Classification E-value
Superfamily SRCR-like 9.02e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000496
Further Details:      
 
Domain Number 4 Region: 199-304
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000439
Further Details:      
 
Domain Number 5 Region: 685-788
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000463
Further Details:      
 
Domain Number 6 Region: 328-433
Classification Level Classification E-value
Superfamily SRCR-like 5.49e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000479
Further Details:      
 
Domain Number 7 Region: 814-918
Classification Level Classification E-value
Superfamily SRCR-like 6.41e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000403
Further Details:      
 
Domain Number 8 Region: 554-660
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000417
Further Details:      
 
Domain Number 9 Region: 1074-1180
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000424
Further Details:      
 
Domain Number 10 Region: 1544-1651
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000835
Further Details:      
 
Domain Number 11 Region: 456-551
Classification Level Classification E-value
Superfamily SRCR-like 1.11e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000672
Further Details:      
 
Domain Number 12 Region: 1426-1538
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-33
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 13 Region: 1668-1777
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-33
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 14 Region: 1199-1271
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003108   Gene: ENSGGOG00000003157   Transcript: ENSGGOT00000003178
Sequence length 2074
Comment pep:known_by_projection chromosome:gorGor3.1:10:136625075:136704594:1 gene:ENSGGOG00000003157 transcript:ENSGGOT00000003178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISTAILEMCLLWGQVLSTGGWIPRTTDYASLIPSEVPLDTIVAEGSLIPSGSTLESTV
AEGSDSGLALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAP
GNAWFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRP
ESWPVRISPPVPTEGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVC
RQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVI
CSASQSRPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYW
DTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLTHNC
GHSEDAGVICSAAHSWSTPGPDTLPTITLPASTVGDRCQGRVEVLYRGSWGTVCDDSWDT
NDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGH
GEDAGVICSGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGC
GWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVVCSPAQ
SQSTPRPDTLSTITLPPSTVGSESSLALRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTS
DANVVCRQLGCGRATSAPGNAWFGQGSGPIVLDDVRCSGQESYLWSCPHNGWLSHNCGHH
EDAGVICSVSQSRPTPSPDTWPTSHAPTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGT
VCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNG
WLSHNCQHSEDAGVICSAAHSWSTPRPDALPTITLPASTVGSESSLALRLVNGGDRCQGR
VEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGH
ESYLWSCPHNGWLSHNCGHGEDAGVICSASQSRPTPSPDTWPTSHAPTAGSESSLALRLV
NGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIV
LDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSWPTPSPDTWPTSRASTAGD
TNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGQESYLWSCPHNGWLSHNCG
HHEDAGVICSAAQSQSTPRPDTWLTTNLPAPPIGSESSLALRLVNGGDRCQGRVEVLYRG
SWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSC
PHNGWLTHNCGHSEDAGVICSATQINSTTTDWWHPTTTTTARPSSNCGGFLFYASGTFSS
PSYPAYYPNNAKCVWEIEVNSGYRINLGFSNLKLEAHHNCSFDYVEIFDGSLNSSLLLGK
ICNDTRQIFTSSYNRMTVHFRSDISFQNTGFLAWYNSFPSDATLRLVNLNSSYGLCAGRV
EIYHGGTWGTVCDDSWTIQEAEVVCRQLGCGRAVSALGNAYFGSGSGPITLDDVECSGTE
STLWQCRNRGWFSHNCNHREDAGVICSGNQLSTPAPFLNITRPNTDYSCGGFLSQPSGDF
SSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYHSSPLIAR
VCDGARGSFTSSSNFMSIRFISDHSITRRGFRAEYYSSPSNDSTNLLCLPNHMQASVSRS
YLQSLGFSASDLVISTWNGYYECRPQITPNLVIFTIPYSGCGTFKQADNDTIDYSNFLTA
AASGGIIKRRTDLRIHVSCRMLQNTWVDTMYIANDTIHIANDTIQVEEVQYGNFDVNISF
YTSSSFLYPVTSHPYYVDLNQDLYVQAEILHSDAALTLFVDTCVASPYSNDFTSLTYDLI
RSGCVRDDTYGPYSSPSLRIARFRFRAFHFLNRFPSVYLRCKMVVCRAYDPSSRCYRGCV
LRSKRDVGSYQEKVDVVLGPIQLQTPPRREEEPR
Download sequence
Identical sequences ENSGGOP00000003108 ENSGGOP00000003108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]