SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003269 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003269
Domain Number 1 Region: 37-97
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-27
Family KRAB domain (Kruppel-associated box) 0.00063
Further Details:      
 
Domain Number 2 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 401-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 498-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 320-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.34e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 279-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000035
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 7 Region: 360-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000627
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000013
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003269
Domain Number - Region: 128-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00172
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003269   Gene: ENSGGOG00000003326   Transcript: ENSGGOT00000003343
Sequence length 555
Comment pep:known_by_projection chromosome:gorGor3.1:16:79920115:79926930:1 gene:ENSGGOG00000003326 transcript:ENSGGOT00000003343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPDLAHGGHVSRDSVCLHEEQTQAAGMVAGCLINCYQDSVTFDDVAVDFTQEEWTLLD
PSQRDLYRDVMLENYENLASVGHHLFKPSVIYWLEEEEELRAGRRGVLQEWRLKTKGPAL
RQDRSVQTSNETQTARSHNGGQLCDHTQCGEAFSEHSGLSTHVRTQNTGDSCVSNHYERD
FFIPCQKTLFKIGEQFSVLGQCGKAFSPTPNVVSQQACTRDRSLDCSDCGEAFLNQSYLQ
ARAGSHNGEGTWKWKPCGKALTHSTGCATPVEMHAIRNPHVCRECGKAFRYTAYLTSRVQ
VHTGEKPCELEECGKASPVSSSLTQHVRIHAAEKPCECKECGKAFTGLSGLSKHVQTDPG
QKPYECKDCGKACGGFYLLNEHGKTHTREKPFACVVCGKYFRNSSCLNNHVRIHTGIKPY
TCSYCGKAFTVRCGLTRHVRTHTGEKPYVCKDCGKAFCTSSGLTEHVRTHTGEKPYECKD
CGKSFTVSSSLTEHARIHTGEKPYECKQCGKAFTGRSGLTKHTRTHTGEKPYECKDCGKA
YNRVYLLNEHVKTHQ
Download sequence
Identical sequences ENSGGOP00000003269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]