SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003273 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003273
Domain Number 1 Region: 303-355
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000259
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003273   Gene: ENSGGOG00000003330   Transcript: ENSGGOT00000003347
Sequence length 359
Comment pep:known_by_projection chromosome:gorGor3.1:5:48498743:48502590:1 gene:ENSGGOG00000003330 transcript:ENSGGOT00000003347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFD
EIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFL
VLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLR
YILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKIKSALKKAV
GGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKM
KTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN
Download sequence
Identical sequences G3QLC4
ENSGGOP00000003273 XP_004041940.1.27298 ENSGGOP00000003273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]