SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003295 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003295
Domain Number 1 Region: 1884-2130
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.35e-56
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 976-1310
Classification Level Classification E-value
Superfamily L domain-like 2.92e-47
Family Internalin LRR domain 0.044
Further Details:      
 
Domain Number 3 Region: 173-614
Classification Level Classification E-value
Superfamily ARM repeat 7.78e-26
Family Armadillo repeat 0.069
Further Details:      
 
Domain Number 4 Region: 1331-1491
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.8e-25
Family G proteins 0.0027
Further Details:      
 
Domain Number 5 Region: 2195-2475
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000666
Family WD40-repeat 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003295
Domain Number - Region: 31-232
Classification Level Classification E-value
Superfamily ARM repeat 0.000242
Family HEAT repeat 0.062
Further Details:      
 
Domain Number - Region: 535-791
Classification Level Classification E-value
Superfamily ARM repeat 0.0144
Family Armadillo repeat 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003295   Gene: ENSGGOG00000003336   Transcript: ENSGGOT00000003370
Sequence length 2527
Comment pep:known_by_projection chromosome:gorGor3.1:12:37909493:38075070:1 gene:ENSGGOG00000003336 transcript:ENSGGOT00000003370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSEHASKLFQGKNI
HVPLLIVLDSYMRVASVQQVGWSLLCKLIEICPGTMQSLMGPQDVGNDWEVLGVHQLILK
MLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLG
CKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVE
VLMSGNVRCYNIVVEAMKAFPISERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQ
QYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWH
RKNKHVQEAACWALNNLLMYQKSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASAN
ALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIM
AVVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKN
DIHKLVLAALNRFIGNPGIQKCGLKVISSVVHFPDALEMLSLEGAMDSVLHTLQMYPDDQ
EIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSTLYRFKDVAEIQTKGFQTILAILKLSA
SFSNLLVHHSFDLVIFHQMSSNIMEQKFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSI
MVECLLLLGADANQAKEGSSLICKVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGD
SQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMV
IRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFL
VKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLKGSS
KLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISGHLEHLEKLELHQNA
LTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKC
PTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHIS
SLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNIPHLRSLD
MSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPP
EIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELRLNFDFKHIGCKAKDIIRFL
QQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRD
KRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARA
SSSPVILVGTHLDVSDEKQRKACLSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRK
TIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPVEFPVIDRKRLLQLVRENQL
QLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHP
KGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIEL
PHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNW
SPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICG
EGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEEDSVHASEKPQGTFPLCGAIYFSGEP
RQSSIKYWRDRMSEYQDWPPYLEGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELV
VLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGL
RYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPE
VARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCA
PWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRHILLPKNITVECMVATHHNS
RNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSG
TLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKA
KLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRT
SQRFSYAAFSDSNIVTVVVDTALYIAKQNSPVVEVWDKKTEKLYELIDCVHLLREVTVKE
NKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMT
AQLGSLKNVMLVLGYNRKSTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEK
MRGTSVE
Download sequence
Identical sequences ENSGGOP00000003295 ENSGGOP00000003295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]