SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003384 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003384
Domain Number 1 Region: 1004-1108
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000805
Further Details:      
 
Domain Number 2 Region: 758-864
Classification Level Classification E-value
Superfamily SRCR-like 6.8e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 544-652
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000082
Further Details:      
 
Domain Number 4 Region: 437-542
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000082
Further Details:      
 
Domain Number 5 Region: 107-210
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 6 Region: 2-105
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00027
Further Details:      
 
Domain Number 7 Region: 1218-1312
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 8 Region: 330-431
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00024
Further Details:      
 
Domain Number 9 Region: 253-326
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 10 Region: 1112-1171
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003384   Gene: ENSGGOG00000003444   Transcript: ENSGGOT00000003461
Sequence length 1313
Comment pep:novel chromosome:gorGor3.1:10:136811062:136879421:1 gene:ENSGGOG00000003444 transcript:ENSGGOT00000003461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVRLLNGTGRCSGRMEVLVQGTWRTVCDDLWNLAKATVVCRQLQCGQAVAAPTGAHFGA
GSGKILLDDVQCVGSKSHLGQCVHGGRARHNCGHLEDASVICSARAWMEVRLLNGTGRCS
GRVEVLVQGTWGTVCDDLWDLAEATVVCRQLQCGQAVAAPTGAHFGAGSGKILLDDMQCV
GSESHLGQCMHGDQARHNCGHLEDASVICTVTTSEMEIEVIFSFQNLFYGCLKGKSFGKW
DLIAKTQIHQDLNSDLAEATIVCHQLQCGQAMAARIRDHFWPGSRKILLDDLQHVGSESH
LGQCVHRSWTRHNCGHLENASIICTTAGACVEVRLLNGTGRCLGRVEVLIQGTWGMVCDD
FWDLAEAAVVCRQLQCGQAVAAPVGAHFGASSGKVLLDDMQCVGSKSHLGRCVRRGWARH
NCGHLEDASVIGAEKGDWPELRLVGGSGRCSGRVEILHQGAWGTVCDGLWDLNEAEVVCR
QLGCGRAMSALGKAHFGPGSGDIFLDNLQCAGVERYLGQCTHSGWSEHNCGHHEDASVIC
SAEGWPELRLMGGSGRCSGRVEIHHQGAWGTVCDDLWDLNEAKVVCRQLGCGQAVSGPGE
AHFGPGSGDIFLDNLQCAGVEHYLGQCTHLGWSEHNCGHHEDASVICSELTQLQSPSLLG
QGPCQRRVEVAQGGQENVLCKQSFQSQVQFAPCKHTACQIKALKVEPQPFSPDRALPLCS
MKSQSPLWSSPQTQKLEITCYLKLIKLRNKILLCLEDGPELRLVGGSGQCSGHVEVLHKG
SWGTVCDDLWDLNEAEVVCQQLGCGQAIAAPGKAHFGPGSGDILLDNIQCSGSENHLGQC
PSSGWSDHNRGHHEDANVVCSGKKRYIECQTVSQIHKSRMDFCVPWLPQGQWILGENCSD
HMDPKDSPLLLQRNKCGSALCELTLRERKEMTSHVWQQNRHKHGDPGHLQRWELLLLSLD
QCVQGYTESVCMTASCEKSSTPCECQKPRLHHTQGGRSLECLQGLGLRLVNGSSRCEGRV
EVYHANAWGTVCDDSWSIEDAHVVCRQLGCGLAVSALPGASFSPGSGSILLDDVNCTGRE
SSLGQCPHSGWYTHNCGHHEDAGVICLALPIVKLADERSQCKGHIEVYHNGTWGTVCDNL
WGVNAAHMVCQQLGCGEGVGHPREWPLGCRGGGWRRLEFISHIKLNISSYQCISGNAASW
KKGIISTSEEIWLMHAEPPLRLAGGRSRCEGRVELRHQGVWGTVCDDHWNIRNARVVCRL
LGCGRAFGQGSGPILLDDVRCTGHEDELERCTHSGWARHNCQHREDAGVVCAG
Download sequence
Identical sequences ENSGGOP00000003384 ENSGGOP00000003384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]