SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003416 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003416
Domain Number 1 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.18e-23
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 2 Region: 27-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-21
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 3 Region: 357-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-20
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 4 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 190-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000015
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 6 Region: 154-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000106
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003416
Domain Number - Region: 117-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00126
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003416   Gene: ENSGGOG00000003476   Transcript: ENSGGOT00000003493
Sequence length 417
Comment pep:known_by_projection chromosome:gorGor3.1:19:9845439:9852251:-1 gene:ENSGGOG00000003476 transcript:ENSGGOT00000003493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSREPICPFEEKTKIGTMVEDHRSNSYQDSVTFDDVAVEFTPEEWALLDTTQKYLYRDV
MLENYMNLASVDFFFCLTSEWEIQPRTKRSSLQQGFLKNQIFTGIQMQTRSYSGWKLCEN
CGEVFSEQFCLKTHMRAQNGGNTFEGNCYGKDILSVHKEASIGQELSKFNPCGKVFTLTP
GLAVHLEILNGRQPYKCKECGKGFKYFASLDNHMGIHIGEKLCEFQECERAITTSSHLKQ
CVAVHTGKKSEKTKNCGKSFTNFSQLSAHAKTHKGEKSFECKECGRSFRNSSSFNVHIQI
HTGIKPHKCTECGKAFTRSTHLTQHVRTHTGIKPYECKECGQAFTQYTGLAIHIRNHTGE
KPYQCKECGKAFNRSSTLTQHRRIHTGEKPYECVECGKTFITSSHRSKHLKTHSGER
Download sequence
Identical sequences ENSGGOP00000003416 ENSGGOP00000003416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]