SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003477 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003477
Domain Number 1 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-25
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 4-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-24
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 5 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.97e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 417-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000104
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003477   Gene: ENSGGOG00000003541   Transcript: ENSGGOT00000003556
Sequence length 517
Comment pep:known_by_projection chromosome:gorGor3.1:19:53928668:53938880:-1 gene:ENSGGOG00000003541 transcript:ENSGGOT00000003556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGSELFRDVAIVFSQEEWQWLAPAQRDLYRDVMLETYSNLVSLGLAVSKPDVISFLEQ
GKEPWMVERVVSGGLCPVLESRYDTKELFPKQHVYEVESPQWEIMESLTSYGLECSSFQD
DWECRNQFDRQQGNPDRHFHQMIIRHEEMPTFDQHASLTFYQKIHTREKPFGYNKCRKDF
WQKELLINHQGIHTNEKPYKCKECGKAFKYGSRLIQHENIHSGKKPYECKECGKAFNSGS
NFIQHQRVHTGEKPYECKDCEKAFSRSSQLIEHQRTHTGEKPYQCKECGKAFNRISHLKV
HYRIHTGEKPYACKECGKTFSHRSQLIQHQTVHTGRKLYECKECGKAFNQGSTLIRHQRI
HTGEKPYECKVCGKAFRVSSQLKQHQRIHTGEKPYQCKVCGRAFKRVSHLTVHYRIHTGE
KPYECKECGKAFSHCSQLIHHRVIHTEKKPYEYKKCEKTLSHDSTTVQPQRMHNRETHVN
IINVEKPSISSYPLLIIREFMLASNHMNGSNGENPLA
Download sequence
Identical sequences G3QLV8
XP_004061558.1.27298 ENSGGOP00000003477 ENSGGOP00000003477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]