SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003612 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003612
Domain Number 1 Region: 433-482
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000968
Family HLH, helix-loop-helix DNA-binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003612   Gene: ENSGGOG00000003667   Transcript: ENSGGOT00000003693
Sequence length 528
Comment pep:known_by_projection chromosome:gorGor3.1:19:1611186:1648822:-1 gene:ENSGGOG00000003667 transcript:ENSGGOT00000003693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGKSGERGAYASF
GRDAGVGGLTQAGFLSGELALSSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPK
KVRKVPPGLPSSVYPPGSGEDYGRDAAAYPSAKTPSSAYPAPFYVADGSLHPSAELWSPP
GQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSAS
SFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSS
SPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGT
AGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGT
LPDLSRPPDSYSRLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQV
RERNLNPKAACLKRREEEKASGVVGDPQMVLSAPHPGLSEAHNPAGHM
Download sequence
Identical sequences ENSGGOP00000003612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]