SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003727 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003727
Domain Number 1 Region: 53-308
Classification Level Classification E-value
Superfamily L domain-like 6.24e-51
Family Ngr ectodomain-like 0.00000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003727   Gene: ENSGGOG00000003795   Transcript: ENSGGOT00000003814
Sequence length 321
Comment pep:known_by_projection chromosome:gorGor3.1:12:90071932:90107864:-1 gene:ENSGGOG00000003795 transcript:ENSGGOT00000003814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDHDFEPSLGPVCPFRCQC
HLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKV
SPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIG
LPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDN
NKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWE
IQPSTFRCVYVRSAIQLGNYK
Download sequence
Identical sequences ENSGGOP00000003727 ENSGGOP00000003727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]