SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003768 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003768
Domain Number 1 Region: 42-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.46e-35
Family SCAN domain 0.00007
Further Details:      
 
Domain Number 2 Region: 461-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 160-209
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.05e-18
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 365-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-17
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 5 Region: 401-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000966
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003768   Gene: ENSGGOG00000003837   Transcript: ENSGGOT00000003858
Sequence length 517
Comment pep:known_by_projection chromosome:gorGor3.1:11:6924081:6949200:1 gene:ENSGGOG00000003837 transcript:ENSGGOT00000003858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLSKLMAISEPRNLSLREQRQVLRADMSWQQETIPVVETHDSEASRQKFRHFQYLKVS
GPHEALSQLWELCLQWLRPEIHTKKQIIELLVLEQFLAILPEEVRTWVNLQHPNNSKDMV
TLIEDVIEMLEDEDMPCKDSAPQMGSIKEKMKAGSGTGKPQEPVTFKDVVVEFSKEEWGQ
LDSAVKNLYRNVMLENFRNLNSLRKAHLLSKPFESLKLESKKKRWIMEKEIPRNTIFDMK
SISGEESSHGVIMTRLTESGHPSSDAWKGENWLYRNQKKWDINLPQEAFIPETIYTEEED
FECSENKKSFDINSISSICATQQGIPSKKGSPKCDKFKTHFKFNLDSVGKQHSEYEYRND
LSLSTDIRQQKIHTTMNSYECYQCGKAFCRSSSLIRHQIIHTGEKPYKCSECGRFFNRRT
NLTKHQKLHAEAKACTSNKCGKAFSKSEDSNNPTLHFGNNFYECVNCGKSFNRSSSLIRH
QMIHTGEKPFKCKECNKAFNRSSNLVKHQKLHTRDKS
Download sequence
Identical sequences ENSGGOP00000003768 ENSGGOP00000003768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]