SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003791 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003791
Domain Number 1 Region: 222-299
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.24e-22
Family Intermediate filament protein, coiled coil region 0.00049
Further Details:      
 
Domain Number 2 Region: 1-24
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000131
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000146
Family Intermediate filament protein, coiled coil region 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003791
Domain Number - Region: 113-223
Classification Level Classification E-value
Superfamily Prefoldin 0.000175
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003791   Gene: ENSGGOG00000023133   Transcript: ENSGGOT00000003885
Sequence length 374
Comment pep:known_by_projection chromosome:gorGor3.1:12:50828069:50834714:-1 gene:ENSGGOG00000023133 transcript:ENSGGOT00000003885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFASFIDKVRFLEQQNKVLETKWNLLQQQTTTTSSKNLEPLFETYLSVLRKQLDTLGNDK
GRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYMNKVELEAKVDSLN
DEINFLKVLYDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEA
EALYQTKVQQLQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQCQTLQASVADA
EQRGENALKDAHSKRVELEAALQQAKEELARMLREYQELMSVKLALDIEIATYRKLLEGE
EYRMSGECQSAVSISVVSGSTSAGGISGGLGSGSGFGLSSGFGSGSGSGFGFGGSVSGSS
SSKIISTTTLNKRR
Download sequence
Identical sequences ENSGGOP00000003791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]