SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003802 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003802
Domain Number 1 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-24
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 4 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 446-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.75e-20
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 8 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000157
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003802   Gene: ENSGGOG00000001955   Transcript: ENSGGOT00000003896
Sequence length 514
Comment pep:known_by_projection chromosome:gorGor3.1:19:20972468:20981661:-1 gene:ENSGGOG00000001955 transcript:ENSGGOT00000003896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPLQFRDVAIEFSLEEWHCLDTAQRNLYRDVMLENYRNLVFLGIVVSKPDFITCLEQGKK
PLTMKKHEMVANPSVTCSHFARDLWPEQSIKDSFQKVTLRRYENYGHDNLQFKKGCESVD
ECKVHKRGYNGLNQYLTTTQSKIFQCDKYVKVIHKFSNSNRHKIRHTGKKPFKCIECGKA
FNQPSTLTTHKKIHTGEKPFKCEECGKAFNWSSHLTTHKIIHTGEKRYKCEDCGKAFSRF
SYLTAHKIIHSGEKPYKCEECGKAFKRSSILTAHKIIHTGEKPYKCEECGKAFKHPSVLT
THKRIHTGEKPYKCEECGRAFKYFSSLTTHKIIHSGEKPYKCEECGKAFNWSSHLTTHKR
IHTGEKPYKCEECGEAFKHSSSLTTHKIIHTGQQPFKCEECGKAFKCFSILTTHKRIHTG
EKPYKCEECGKAFNSSSHLTAHKRIHTGEKPYKCERCGKAFKRSFILTRHKRIHTGEKPY
KCEECGKGFKCPSTLTTHKVIHTGEKYKCEECGK
Download sequence
Identical sequences ENSGGOP00000003802 ENSGGOP00000003802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]