SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003815 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003815
Domain Number 1 Region: 30-204
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.13e-52
Family MHC antigen-recognition domain 0.0000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003815   Gene: ENSGGOG00000003891   Transcript: ENSGGOT00000003910
Sequence length 244
Comment pep:known_by_projection chromosome:gorGor3.1:6:150983454:151053191:-1 gene:ENSGGOG00000003891 transcript:ENSGGOT00000003910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAASPAVLPRLAILPYLLFDWSGTGRADTHSLWYNFTIIHLPRHGQQWCEVQSQVDQK
NVLSYDCGSDKVLSMGHLEEQLDATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPL
MLQARMSCECEADGCIRGSWQFSFDGQKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLT
TFFKMVSMGDCKSWLRDFLMHRKKRLEPTAPPTVAPGLAQPKAIATTLSPWSFLIILCFI
LPGI
Download sequence
Identical sequences G3QMS0
ENSGGOP00000003815 ENSGGOP00000003815 XP_004044871.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]