SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003870 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003870
Domain Number 1 Region: 240-456
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.36e-67
Family Fibrinogen C-terminal domain-like 0.00000734
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003870
Domain Number - Region: 57-209
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0471
Family HBL-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003870   Gene: ENSGGOG00000003946   Transcript: ENSGGOT00000003966
Sequence length 460
Comment pep:known_by_projection chromosome:gorGor3.1:1:64639440:64646827:1 gene:ENSGGOG00000003946 transcript:ENSGGOT00000003966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTIKLLLSIVPLVISSTIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDF
VHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL
NSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQ
TVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHD
GIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWE
NYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTL
HLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKP
RAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Download sequence
Identical sequences G3QMX2
ENSGGOP00000003870 XP_004025951.1.27298 ENSGGOP00000003870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]