SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003945 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003945
Domain Number 1 Region: 284-339
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000221
Family RING finger domain, C3HC4 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003945   Gene: ENSGGOG00000004021   Transcript: ENSGGOT00000004042
Sequence length 344
Comment pep:known_by_projection chromosome:gorGor3.1:2a:88304777:88344014:1 gene:ENSGGOG00000004021 transcript:ENSGGOT00000004042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQDAELSGTLSLVLTQCCKRIKDTVQKLASDHKDIHSSVSRVGKAIDKNFDSDISSVGID
GCWQADSQRLLNEVMVEHFFRQGMLDVAEELCQESGLSVDPSQKEPFVELNRILEALKVR
VLRPALEWAVSNREMLIAQNSSLEFKLHRLYFISLLMGGTTNQREALQYAKNFQPFALNH
QKDIQVLMGSLVYLRQGIENSPYVHLLDANQWADICDIFTRDACALLGLSVESPLSVSFS
AGCVALPALINIKAVIEQRQCTGVWNQKDELPIEVDLGKKCWYHSIFACPILRQQTTDNN
PPMKLVCGHIISRDALNKMFNGSKLKCPYCPMEQSPGDAKQIFF
Download sequence
Identical sequences A0A2I3GFT1 A0A2K5ZEH7 G7NAK2 G7PMN3
ENSFCAP00000022239 ENSGGOP00000003945 ENSGGOP00000003945 ENSNLEP00000003496 9823.ENSSSCP00000008771 ENSNLEP00000003496 ENSSSCP00000008771 ENSSSCP00000008771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]