SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004013 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004013
Domain Number 1 Region: 877-1092
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7.18e-53
Family Complement components 0.00026
Further Details:      
 
Domain Number 2 Region: 1173-1301
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.23e-31
Family Alpha-macroglobulin receptor domain 0.0012
Further Details:      
 
Domain Number 3 Region: 713-766
Classification Level Classification E-value
Superfamily E set domains 0.00000000238
Family SVA-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004013   Gene: ENSGGOG00000004082   Transcript: ENSGGOT00000004110
Sequence length 1339
Comment pep:known_by_projection chromosome:gorGor3.1:6:73466021:73597240:1 gene:ENSGGOG00000004082 transcript:ENSGGOT00000004110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKA
ELLKTASNLTVSVLEAEGVFEKGSFKTLTLPSLPLNSADEIYELRVTGRTQDEILFSNST
RLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWL
SQQSDLGVISKTFQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYYTYGKPVKGDVTLTFL
PLSFWGKKKNITKTFKINGSANFSFNDEEMKNVMDSSNGLSEYLDLSSPGPVEILTTVTE
SVTGISRNASTNVFFKQHDYIIEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNV
VITVTQRNYTEYWSGSNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLG
SKSSMAVHSLFKSPSKTYIQLKTRDENIKVGSPFELVVSGNKRLKELSYMVVSRGQLVAV
GKQNSTMFSLTPENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVFKNKIKLYWSKVKAE
PSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMENVVHELELYNTGYYLGMFMNS
FAVFQECGLWVLTDANLMKDYIDGVYDNAEYAERFMEENEGHIVDIHDFSLGSSPHVRKH
FPETWIWLDTNMGSRIYQEFEVTVPDSITSWVATGFVISGDLGLGLTTTPVELQAFQPFF
IFLNLPYSVIRGEEFALEITIFNYLKDATEVKVIIEKSDKFDILMTSSEINATGHQQTLL
VPSEDGATVLFPIRPTHLGEIPITVTALSSTASDAITQMILVKAEGIEKSYSQSILLDLT
DSRLQSTLKTLSFSFPPNTVTGSERVQVTAIGDVLGPSINGLASLIRMPYGCGEQNMINF
APNIYILDYLTKKKQLTDNLKEKALSFMRQGYQRELLYQREDGSFSAFGNYDPSGSTPNI
DVQESIHFLESEFSRGISDNYTLALITYALSSVGSPKAKEALNMLTWRAEQEGGMQFWVS
SESKLSDSWQPRSLDIEVAAYALLSHFLQFQTSEGIPIMRWLSRQRNSLGGFASTQDTTV
ALKALSEFAALMNTERTNIQVTVTGPSSPSPIKFLIDTHNRLLLQTAELAVVQPTAVNIS
ANGFGFAICQLNVVYNVKASGSSRRRRSIQNPEAFDLDVAVKENKDDLNHVDLNVCTSFS
GPGRSGMALMEVNLLSGFMVPSEAISLSETVKKVEYDHGKLNLYLDSVNETQFCVNIPAV
RNFKVSNTQDASVSIVDYYEPRRQAVRSYNSEVKLSSCDLCSDVQGCRPCEDGASGSHHH
PSVIFIFCFMLLYFLELWL
Download sequence
Identical sequences ENSGGOP00000004013 ENSGGOP00000004013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]